Anti-TMEM72
Catalog Number:
ATA-HPA062907
- Images (9)
| Article Name: | Anti-TMEM72 |
| Biozol Catalog Number: | ATA-HPA062907 |
| Supplier Catalog Number: | HPA062907 |
| Alternative Catalog Number: | ATA-HPA062907-100,ATA-HPA062907-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | bA285G1.3, C10orf127, KSP37 |
| transmembrane protein 72 |
| Anti-TMEM72 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 643236 |
| UniProt: | A0PK05 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LQPPNTLMELSLEPADSLAKKKQVHFEDNLVRIVPSLAEGLDD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TMEM72 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human kidney and lymph node tissues using Anti-TMEM72 antibody. Corresponding TMEM72 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, colon, kidney and lymph node using Anti-TMEM72 antibody HPA062907 (A) shows similar protein distribution across tissues to independent antibody HPA039894 (B). |
|
|
Immunohistochemical staining of human kidney shows high expression. |
|
|
Immunohistochemical staining of human lymph node shows low expression as expected. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-TMEM72 antibody HPA062907. |
|
|
Immunohistochemical staining of human colon using Anti-TMEM72 antibody HPA062907. |
|
|
HPA062907-100ul |
|
|
HPA062907-100ul |
|
|
HPA062907-100ul |
Product Guarantee and Expert Support
