Anti-LIN28A

Catalog Number: ATA-HPA063074
Article Name: Anti-LIN28A
Biozol Catalog Number: ATA-HPA063074
Supplier Catalog Number: HPA063074
Alternative Catalog Number: ATA-HPA063074-100,ATA-HPA063074-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CSDD1, FLJ12457, LIN-28, LIN28, ZCCHC1
Clonality: Polyclonal
Isotype: IgG
NCBI: 79727
UniProt: Q9H9Z2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN
Target: LIN28A
Antibody Type: Monoclonal Antibody
HPA063074-100ul