Anti-GZMK
Catalog Number:
ATA-HPA063181
- Images (7)
| Article Name: | Anti-GZMK |
| Biozol Catalog Number: | ATA-HPA063181 |
| Supplier Catalog Number: | HPA063181 |
| Alternative Catalog Number: | ATA-HPA063181-100,ATA-HPA063181-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | PRSS, TRYP2 |
| granzyme K (granzyme 3, tryptase II) |
| Anti-GZMK |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 3003 |
| UniProt: | P49863 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | GZMK |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human tonsil and cerebral cortex tissues using Anti-GZMK antibody. Corresponding GZMK RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human tonsil shows high expression. |
|
|
Immunohistochemical staining of human cerebral cortex shows low expression as expected. |
|
|
Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue. |
|
|
HPA063181-100ul |
|
|
HPA063181-100ul |
|
|
HPA063181-100ul |
Product Guarantee and Expert Support
