Anti-CCR2

Catalog Number: ATA-HPA063255
Article Name: Anti-CCR2
Biozol Catalog Number: ATA-HPA063255
Supplier Catalog Number: HPA063255
Alternative Catalog Number: ATA-HPA063255-100,ATA-HPA063255-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CC-CKR-2, CD192, CKR2, CMKBR2, FLJ78302, MCP-1-R
Clonality: Polyclonal
Concentration: 0,5
NCBI: 729230
UniProt: P41597
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEG
Target: CCR2
HPA063255-100ul