Anti-AK3

Catalog Number: ATA-HPA063324
Article Name: Anti-AK3
Biozol Catalog Number: ATA-HPA063324
Supplier Catalog Number: HPA063324
Alternative Catalog Number: ATA-HPA063324-100,ATA-HPA063324-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: AK3L1, AK6, AKL3L1
adenylate kinase 3
Anti-AK3
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Isotype: IgG
NCBI: 50808
UniProt: Q9UIJ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: AK3
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000
Immunofluorescent staining of human cell line Hep G2 shows localization to mitochondria.
Immunohistochemistry analysis in human kidney and pancreas tissues using Anti-AK3 antibody. Corresponding AK3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human kidney shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA063324-100ul
HPA063324-100ul
HPA063324-100ul