Anti-SCN5A Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-SCN5A Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA063346
• Supplier Catalog Number: HPA063346
• Alternative Catalog Number: ATA-HPA063346-100, ATA-HPA063346-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CDCD2, CMD1E, CMPD2, HB1, HB2, HBBD, HH1, ICCD, IVF, LQT3, Nav1.5, PFHB1, SSS1

Product Properties

• Clonality: Polyclonal
• NCBI: 6331
• UniProt: Q14524
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: HKCVRNFTALNGTNGSVEADGLVWESLDLYLSDPENYLLKNGTS
• Target: SCN5A