Anti-CRYGS

Catalog Number: ATA-HPA063539
Article Name: Anti-CRYGS
Biozol Catalog Number: ATA-HPA063539
Supplier Catalog Number: HPA063539
Alternative Catalog Number: ATA-HPA063539-100,ATA-HPA063539-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CRYG8
Clonality: Polyclonal
Isotype: IgG
NCBI: 1427
UniProt: P22914
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MSKTGTKITFYEDKNFQGRRYDCDCDCADFHTYLSRCNSIKV
Target: CRYGS
Antibody Type: Monoclonal Antibody
HPA063539-100ul