Anti-NFIC

Catalog Number: ATA-HPA063560
Article Name: Anti-NFIC
Biozol Catalog Number: ATA-HPA063560
Supplier Catalog Number: HPA063560
Alternative Catalog Number: ATA-HPA063560-100,ATA-HPA063560-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CTF, CTF5, NF-I, NFI
Clonality: Polyclonal
Concentration: 0,1
NCBI: 4782
UniProt: P08651
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QDPLKDLVSLACDPASQQPGPLNGSGQLKMPSHCLSAQMLAPP
Target: NFIC
HPA063560-100ul