Anti-CRTC1

Catalog Number: ATA-HPA063619
Article Name: Anti-CRTC1
Biozol Catalog Number: ATA-HPA063619
Supplier Catalog Number: HPA063619
Alternative Catalog Number: ATA-HPA063619-100,ATA-HPA063619-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ14027, KIAA0616, MECT1, TORC1
Clonality: Polyclonal
Isotype: IgG
NCBI: 23373
UniProt: Q6UUV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PEEPTFPALSSSSSTGNLAANLTHLGIGGAGQGMSTPGSSPQHRPAGVSPLSLSTEARR
Target: CRTC1
Antibody Type: Monoclonal Antibody
HPA063619-100ul