Anti-POMC
Catalog Number:
ATA-HPA063644
- Images (8)
| Article Name: | Anti-POMC |
| Biozol Catalog Number: | ATA-HPA063644 |
| Supplier Catalog Number: | HPA063644 |
| Alternative Catalog Number: | ATA-HPA063644-100,ATA-HPA063644-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ACTH, CLIP, LPH, MSH, NPP, POC |
| proopiomelanocortin |
| Anti-POMC |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 5443 |
| UniProt: | P01189 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SQCQDLTTESNLLECIRACKPDLSAETPMFPGNGDEQPLTENPRKYVMGHFRWDRFG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | POMC |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:5000 - 1:10000 |
|
|
Immunohistochemical staining of human cerebral cortex, liver, pituitary gland and testis using Anti-POMC antibody HPA063644 (A) shows similar protein distribution across tissues to independent antibody HPA046135 (B). |
|
|
Immunohistochemical staining of human pituitary gland using Anti-POMC antibody HPA063644. |
|
|
Immunohistochemical staining of human liver using Anti-POMC antibody HPA063644. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-POMC antibody HPA063644. |
|
|
Immunohistochemical staining of human testis using Anti-POMC antibody HPA063644. |
|
|
HPA063644-100ul |
|
|
HPA063644-100ul |
|
|
HPA063644-100ul |
Product Guarantee and Expert Support
