Anti-ARFIP1

Catalog Number: ATA-HPA063759
Article Name: Anti-ARFIP1
Biozol Catalog Number: ATA-HPA063759
Supplier Catalog Number: HPA063759
Alternative Catalog Number: ATA-HPA063759-100,ATA-HPA063759-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HSU52521
ADP-ribosylation factor interacting protein 1
Anti-ARFIP1
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 27236
UniProt: P53367
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MAQESPKNSAAEIPVTSNGEVDDSREHSFNRDLKHSLPSGLGL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ARFIP1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line MCF7 shows localization to the Golgi apparatus.
Immunohistochemistry analysis in human endometrium and skeletal muscle tissues using Anti-ARFIP1 antibody. Corresponding ARFIP1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human endometrium shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
HPA063759-100ul
HPA063759-100ul
HPA063759-100ul