Anti-SLC6A7

Catalog Number: ATA-HPA063773
Article Name: Anti-SLC6A7
Biozol Catalog Number: ATA-HPA063773
Supplier Catalog Number: HPA063773
Alternative Catalog Number: ATA-HPA063773-100,ATA-HPA063773-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PROT
Clonality: Polyclonal
Concentration: 0,1
NCBI: 6534
UniProt: Q99884
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: REEGSLWERLQQASRPAMDWGPSLEENRTGMYVATLAGSQSPKPLMVHMRKYGGITSFENTAIEVDREIA
Target: SLC6A7
HPA063773-100ul