Anti-MARCO Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-MARCO Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA063793
• Supplier Catalog Number: HPA063793
• Alternative Catalog Number: ATA-HPA063793-100,ATA-HPA063793-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: SCARA2

Product Properties

• Clonality: Polyclonal
• NCBI: 8685
• UniProt: Q9UEW3
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: LNLQARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQLTWVRV
• Target: MARCO