Anti-APBB1IP
Catalog Number:
ATA-HPA063903
- Images (8)
| Article Name: | Anti-APBB1IP |
| Biozol Catalog Number: | ATA-HPA063903 |
| Supplier Catalog Number: | HPA063903 |
| Alternative Catalog Number: | ATA-HPA063903-100,ATA-HPA063903-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | INAG1, RIAM |
| amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein |
| Anti-APBB1IP |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 54518 |
| UniProt: | Q7Z5R6 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KTLYDNYQRAVAKAGLASRWTNLGTVNAAAPAQPSTGPKTGTTQPNGQIPQATHSVSAVLQEAQRHAETSKDKKPAL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | APBB1IP |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line BJ shows localization to plasma membrane & cytosol. |
|
|
Immunohistochemistry analysis in human spleen and pancreas tissues using Anti-APBB1IP antibody. Corresponding APBB1IP RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human spleen shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
HPA063903-100ul |
|
|
|
|
|
HPA063903-100ul |
|
|
HPA063903-100ul |
Product Guarantee and Expert Support
