Anti-ACPP

Catalog Number: ATA-HPA063916
Article Name: Anti-ACPP
Biozol Catalog Number: ATA-HPA063916
Supplier Catalog Number: HPA063916
Alternative Catalog Number: ATA-HPA063916-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ACP-3, ACP3
acid phosphatase, prostate
Anti-ACPP
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 55
UniProt: P15309
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LTELYFEKGEYFVEMYYRNETQHEPYPLMLPGCSPSCPLERFAELVGPVIPQDWSTECMTTNSHQGT
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ACPP
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:2500 - 1:5000, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human prostate and endometrium tissues using Anti-ACPP antibody. Corresponding ACPP RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human prostate shows high expression.
Immunohistochemical staining of human endometrium shows low expression as expected.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251 MG
HPA063916-100ul
HPA063916-100ul
HPA063916-100ul