Anti-GCAT

Catalog Number: ATA-HPA063924
Article Name: Anti-GCAT
Biozol Catalog Number: ATA-HPA063924
Supplier Catalog Number: HPA063924
Alternative Catalog Number: ATA-HPA063924-100,ATA-HPA063924-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KBL
Clonality: Polyclonal
Isotype: IgG
NCBI: 23464
UniProt: O75600
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RGAGTWKSERVITSRQGPHIRVDGVSGGILNFCANNYLGLSSHPEVIQAGLQALEEFGAGLSSVRFICGTQ
Target: GCAT
Antibody Type: Monoclonal Antibody
HPA063924-100ul