Anti-TRIM28

Catalog Number: ATA-HPA064033
Article Name: Anti-TRIM28
Biozol Catalog Number: ATA-HPA064033
Supplier Catalog Number: HPA064033
Alternative Catalog Number: ATA-HPA064033-100,ATA-HPA064033-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KAP1, PPP1R157, RNF96, TF1B, TIF1B
tripartite motif containing 28
Anti-TRIM28
Clonality: Polyclonal
Concentration: 0.4 mg/ml
Isotype: IgG
NCBI: 10155
UniProt: Q13263
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TDSTFSLDQPGGTLDLTLIRARLQEKLSPPYSSPQEFAQDVGRMFKQFNKLTEDKADVQSIIGLQRFFETRMNEAFGDTKFSAVLV
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TRIM28
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500
Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm.
Immunohistochemistry analysis in human ovary and liver tissues using Anti-TRIM28 antibody. Corresponding TRIM28 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human ovary shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
HPA064033-100ul
HPA064033-100ul
HPA064033-100ul