Anti-HBZ

Catalog Number: ATA-HPA064073
Article Name: Anti-HBZ
Biozol Catalog Number: ATA-HPA064073
Supplier Catalog Number: HPA064073
Alternative Catalog Number: ATA-HPA064073-100,ATA-HPA064073-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HBZ-T1, HBZ1
Clonality: Polyclonal
Isotype: IgG
NCBI: 3050
UniProt: P02008
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TIIVSMWAKISTQADTIGTETLERLFLSHPQTKTY
Target: HBZ
Antibody Type: Monoclonal Antibody
HPA064073-100ul