Anti-ZHX1, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-ZHX1, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA064462
• Supplier Catalog Number: HPA064462
• Alternative Catalog Number: ATA-HPA064462-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human

Product Description

Rabbit Polyclonal ZHX1 Antibody against Human zinc fingers and homeoboxes 1. Validated for Western Blot

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05
• NCBI: 11244
• UniProt: Q9UKY1
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Sequence: KEEKMEIDESNAGSSKEEAGETSPADESGAPKSGSTGKICKKTPEQLHMLKSAFVRTQWPSPEEYDKLAKESG