Anti-RDH8

Catalog Number: ATA-HPA064473
Article Name: Anti-RDH8
Biozol Catalog Number: ATA-HPA064473
Supplier Catalog Number: HPA064473
Alternative Catalog Number: ATA-HPA064473-100,ATA-HPA064473-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PRRDH, SDR28C2
Clonality: Polyclonal
Isotype: IgG
NCBI: 50700
UniProt: Q9NYR8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VQAIVNVISSTRPPLRRQTNIRYSPLTTLKTVDSSGSLYVRTTHRLLFRCPRLLNLGLQCL
Target: RDH8
Antibody Type: Monoclonal Antibody
HPA064473-100ul