Anti-XPNPEP2

Catalog Number: ATA-HPA064568
Article Name: Anti-XPNPEP2
Biozol Catalog Number: ATA-HPA064568
Supplier Catalog Number: HPA064568
Alternative Catalog Number: ATA-HPA064568-100,ATA-HPA064568-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Clonality: Polyclonal
Isotype: IgG
NCBI: 7512
UniProt: O43895
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTW
Target: XPNPEP2
Antibody Type: Monoclonal Antibody
HPA064568-100ul