Anti-MVP
Catalog Number:
ATA-HPA064740
- Images (8)
| Article Name: | Anti-MVP |
| Biozol Catalog Number: | ATA-HPA064740 |
| Supplier Catalog Number: | HPA064740 |
| Alternative Catalog Number: | ATA-HPA064740-100,ATA-HPA064740-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | LRP, VAULT1 |
| major vault protein |
| Anti-MVP |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 9961 |
| UniProt: | Q14764 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KVSHQAGDHWLIRGPLEYVPSAKVEVVEERQAIPLDENEGIYVQDVKTGKVRAVIGSTYMLTQDEVLWEKELPPGVEELLNKGQDPLAD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MVP |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human small intestine and pancreas tissues using Anti-MVP antibody. Corresponding MVP RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human small intestine shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Western blot analysis in human cell lines A-549 and HEK293 using Anti-MVP antibody. Corresponding MVP RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
HPA064740-100ul |
|
|
|
|
|
HPA064740-100ul |
|
|
HPA064740-100ul |
Product Guarantee and Expert Support
