Anti-PNPLA6

Catalog Number: ATA-HPA064773
Article Name: Anti-PNPLA6
Biozol Catalog Number: ATA-HPA064773
Supplier Catalog Number: HPA064773
Alternative Catalog Number: ATA-HPA064773-100,ATA-HPA064773-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: iPLA2delta, NTE, SPG39, sws
Clonality: Polyclonal
Isotype: IgG
NCBI: 10908
UniProt: Q8IY17
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SYCEDESATGGCPFGPYQGRQTSSIFEAAKQELAKLMRIEDPSLLNSRVLLHHAKAGTIIARQGDQDVSLHFVLWG
Target: PNPLA6
Antibody Type: Monoclonal Antibody
HPA064773-100ul