Anti-LRP2
Catalog Number:
ATA-HPA064792
- Images (9)
| Article Name: | Anti-LRP2 |
| Biozol Catalog Number: | ATA-HPA064792 |
| Supplier Catalog Number: | HPA064792 |
| Alternative Catalog Number: | ATA-HPA064792-100,ATA-HPA064792-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DBS, gp330 |
| low density lipoprotein receptor-related protein 2 |
| Anti-LRP2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 4036 |
| UniProt: | P98164 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | NNDRIYWSDFKEDVIETIKYDGTDRRVIAKEAMNPYSLDIFEDQLYWISKEKGEVWKQNKFGQGKKEKTLVVNPWLTQVRIFHQLRYNKSVP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | LRP2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human parathyroid gland and placenta tissues using HPA064792 antibody. Corresponding LRP2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human lymph node shows no positivity in germinal center cells as expected. |
|
|
Immunohistochemical staining of human small intestine shows no positivity in glandular cells as expected. |
|
|
Immunohistochemical staining of human kidney shows strong membranous positivity in cells in tubules. |
|
|
Immunohistochemical staining of human placenta shows no positivity in trophoblastic cells as expected. |
|
|
Immunohistochemical staining of human parathyroid gland shows strong membranous positivity in glandular cells. |
|
|
HPA064792-100ul |
|
|
HPA064792-100ul |
|
|
HPA064792-100ul |
Product Guarantee and Expert Support
