Anti-ACCSL

Catalog Number: ATA-HPA065042
Article Name: Anti-ACCSL
Biozol Catalog Number: ATA-HPA065042
Supplier Catalog Number: HPA065042
Alternative Catalog Number: ATA-HPA065042-100,ATA-HPA065042-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Clonality: Polyclonal
Isotype: IgG
NCBI: 390110
UniProt: Q4AC99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ASGLELQVPLPSEDSRGDVRYGQRAQLSGQPDPVPQLSDCEAAFVNRDLSIRGIDISVFYQSSFQDYNAYQKDKYHKDKNTLGFINLGT
Target: ACCSL
Antibody Type: Monoclonal Antibody
HPA065042-100ul