Anti-INSL4

Catalog Number: ATA-HPA065145
Article Name: Anti-INSL4
Biozol Catalog Number: ATA-HPA065145
Supplier Catalog Number: HPA065145
Alternative Catalog Number: ATA-HPA065145-100,ATA-HPA065145-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: EPIL
Clonality: Polyclonal
Isotype: IgG
NCBI: 3641
UniProt: Q14641
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: AAELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVSTSNNKDGQALGT
Target: INSL4
Antibody Type: Monoclonal Antibody
HPA065145-100ul