Anti-LGALS14

Catalog Number: ATA-HPA065180
Article Name: Anti-LGALS14
Biozol Catalog Number: ATA-HPA065180
Supplier Catalog Number: HPA065180
Alternative Catalog Number: ATA-HPA065180-100,ATA-HPA065180-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CLC2, PPL13
Clonality: Polyclonal
Isotype: IgG
NCBI: 56891
UniProt: Q8TCE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QFRLHFGHPAIMNSRVFGIWRYEEKCYYLPFEDGKPF
Target: LGALS14
Antibody Type: Monoclonal Antibody
HPA065180-100ul