Anti-STEAP4

Catalog Number: ATA-HPA065201
Article Name: Anti-STEAP4
Biozol Catalog Number: ATA-HPA065201
Supplier Catalog Number: HPA065201
Alternative Catalog Number: ATA-HPA065201-100,ATA-HPA065201-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ23153, SchLAH, STAMP2, TIARP, TNFAIP9
Clonality: Polyclonal
Isotype: IgG
NCBI: 79689
UniProt: Q687X5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TCIDALPLTMNSSEKQETVCIFGTGDFGRSLGLKMLQCGYSVVFGSRNPQKTTLLPSGAEVLSYSEAAKKSDIIIIAIHREHY
Target: STEAP4
Antibody Type: Monoclonal Antibody
HPA065201-100ul