Anti-FANCD2OS

Catalog Number: ATA-HPA065487
Article Name: Anti-FANCD2OS
Biozol Catalog Number: ATA-HPA065487
Supplier Catalog Number: HPA065487
Alternative Catalog Number: ATA-HPA065487-100,ATA-HPA065487-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C3orf24, MGC40179
Clonality: Polyclonal
Concentration: 0,1
NCBI: 115795
UniProt: Q96PS1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: WTPLDESFQWLRHTTPTPSSKHPFKASPCFPHTPSDLEVQLCFQEVTLVLDSPFLESGVSPKLPCHTSELRTMNNKGLVRK
Target: FANCD2OS
HPA065487-100ul