Anti-TM4SF20
Catalog Number:
ATA-HPA065531
| Article Name: |
Anti-TM4SF20 |
| Biozol Catalog Number: |
ATA-HPA065531 |
| Supplier Catalog Number: |
HPA065531 |
| Alternative Catalog Number: |
ATA-HPA065531-100,ATA-HPA065531-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
ICC |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
FLJ22800, TCCE518 |
| transmembrane 4 L six family member 20 |
| Clonality: |
Polyclonal |
| Concentration: |
0.1 mg/ml |
| Isotype: |
IgG |
| NCBI: |
79853 |
| UniProt: |
Q53R12 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
IHPESFNLQWFFNDSCAPPTGFNKPTSNDTMASGWRASSFHFDSEENKHRLIHFSV |
| Storage: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: |
TM4SF20 |
| Antibody Type: |
Monoclonal Antibody |
| Application Dilute: |
ICC-IF: 0.25-2 µg/ml |
![]()
|
Immunofluorescent staining of human cell line SiHa shows localization to plasma membrane & focal adhesion sites. |
![]()
|
HPA065531-100ul |
