Anti-RANBP1

Catalog Number: ATA-HPA065931
Article Name: Anti-RANBP1
Biozol Catalog Number: ATA-HPA065931
Supplier Catalog Number: HPA065931
Alternative Catalog Number: ATA-HPA065931-100,ATA-HPA065931-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HTF9A
RAN binding protein 1
Anti-RANBP1
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 5902
UniProt: P43487
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: AKDTHEDHDTSTENTDESNHDPQFEPIVSL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RANBP1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000
Immunofluorescent staining of human cell line RH-30 shows localization to cytosol.
Immunohistochemistry analysis in human testis and kidney tissues using Anti-RANBP1 antibody. Corresponding RANBP1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human kidney shows low expression as expected.
HPA065931-100ul
HPA065931-100ul
HPA065931-100ul