Anti-SLC30A8

Catalog Number: ATA-HPA065953
Article Name: Anti-SLC30A8
Biozol Catalog Number: ATA-HPA065953
Supplier Catalog Number: HPA065953
Alternative Catalog Number: ATA-HPA065953-100,ATA-HPA065953-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ZnT-8, ZNT8
Clonality: Polyclonal
Concentration: 0,4
NCBI: 169026
UniProt: Q8IWU4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LSAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQMESPVDQDPDCLFCEDPCD
Target: SLC30A8
HPA065953-100ul