Anti-WWC1
Catalog Number:
ATA-HPA066092
| Article Name: |
Anti-WWC1 |
| Biozol Catalog Number: |
ATA-HPA066092 |
| Supplier Catalog Number: |
HPA066092 |
| Alternative Catalog Number: |
ATA-HPA066092-100 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
WB |
| Species Reactivity: |
Human |
| Alternative Names: |
KIAA0869, KIBRA, PPP1R168 |
| Rabbit Polyclonal WWC1 Antibody against Human WW and C2 domain containing 1. Validated for Western Blot |
| Clonality: |
Polyclonal |
| Concentration: |
0.05 |
| NCBI: |
23286 |
| UniProt: |
Q8IX03 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Sequence: |
SGVYEASVQRLGASEAAAFDSDESEAVGATRIQIALKYDEKNKQFAILIIQLSNLSAL |
![]()
|
WB Image Caption 1 |
