Anti-WAPL

Catalog Number: ATA-HPA066141
Article Name: Anti-WAPL
Biozol Catalog Number: ATA-HPA066141
Supplier Catalog Number: HPA066141
Alternative Catalog Number: ATA-HPA066141-100,ATA-HPA066141-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FOE, KIAA0261, WAPAL
Clonality: Polyclonal
Isotype: IgG
NCBI: 23063
UniProt: Q7Z5K2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EEHEKNSHHIHKNADDSTKKPNAETTVASEIKETNDTWNSQFGKRPESPSEISPIKGSVRTGLFEWDNDFEDIRSEDCILSLDSDPLLEMKDD
Target: WAPL
Antibody Type: Monoclonal Antibody
HPA066141-100ul