Anti-CHD9

Catalog Number: ATA-HPA066155
Article Name: Anti-CHD9
Biozol Catalog Number: ATA-HPA066155
Supplier Catalog Number: HPA066155
Alternative Catalog Number: ATA-HPA066155-100,ATA-HPA066155-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: BC022889, FLJ12178, KIAA0308
Clonality: Polyclonal
Isotype: IgG
NCBI: 80205
UniProt: Q3L8U1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SLRSQQNRNNLNPGQNSLSQSKNFMNVSGPHRVNVNHPPQMTNASNSQQSISMQQFSQTSNPSAHFHKCSSHQEGNFNGPSPNMTSCSVSNSQQFSSHYSFSSNHISPNSLLQSSA
Target: CHD9
Antibody Type: Monoclonal Antibody
HPA066155-100ul