Anti-ADAMTS8

Catalog Number: ATA-HPA066349
Article Name: Anti-ADAMTS8
Biozol Catalog Number: ATA-HPA066349
Supplier Catalog Number: HPA066349
Alternative Catalog Number: ATA-HPA066349-100,ATA-HPA066349-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ADAM-TS8, FLJ41712, METH2
ADAM metallopeptidase with thrombospondin type 1 motif, 8
Clonality: Polyclonal
Isotype: IgG
NCBI: 11095
UniProt: Q9UP79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SIATLERLQSFRPLPEPLTVQLLTVPGEVFPPKVKYTFFVPNDVDFSMQSSKERATTNIIQPLLHAQWVL
Target: ADAMTS8
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200
HPA066349-100ul