Anti-SLC34A2

Catalog Number: ATA-HPA066474
Article Name: Anti-SLC34A2
Biozol Catalog Number: ATA-HPA066474
Supplier Catalog Number: HPA066474
Alternative Catalog Number: ATA-HPA066474-100,ATA-HPA066474-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: NAPI-3B
Clonality: Polyclonal
Isotype: IgG
NCBI: 10568
UniProt: O95436
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: APWPELGDAQPNPDKYLEGAAGQQPTAPDKSKETNKNNTEAPVTKIELLP
Target: SLC34A2
Antibody Type: Monoclonal Antibody
HPA066474-100ul