Anti-ARHGAP11A

Catalog Number: ATA-HPA066481
Article Name: Anti-ARHGAP11A
Biozol Catalog Number: ATA-HPA066481
Supplier Catalog Number: HPA066481
Alternative Catalog Number: ATA-HPA066481-100,ATA-HPA066481-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA0013
Clonality: Polyclonal
Isotype: IgG
NCBI: 9824
UniProt: Q6P4F7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ELPSKSFLKMRKHPDSVNASLRSTTVYKQKILSDGQVKVPLDDLTNHDIVKPVVNNNMGISSGINNRVLRRPSERGRAWYKGSPKHPIGKTQLLPTSKPV
Target: ARHGAP11A
Antibody Type: Monoclonal Antibody
HPA066481-100ul