Anti-CD96
Catalog Number:
ATA-HPA066754
- Images (8)
| Article Name: | Anti-CD96 |
| Biozol Catalog Number: | ATA-HPA066754 |
| Supplier Catalog Number: | HPA066754 |
| Alternative Catalog Number: | ATA-HPA066754-100,ATA-HPA066754-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | TACTILE |
| CD96 molecule |
| Anti-CD96 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 10225 |
| UniProt: | P40200 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VPGNKVWNISSEKITFLLGSEISSTDPPLSVTESTLDTQPSPASSVSPARYPATSSVTLVDVSALRPNTTPQPSNSSMTT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CD96 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using HPA066754 antibody. Corresponding CD96 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human lymph node shows moderate cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human lung shows moderate cytoplasmic positivity in macrophages. |
|
|
Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA066754-100ul |
|
|
HPA066754-100ul |
|
|
HPA066754-100ul |
Product Guarantee and Expert Support
