Anti-JUN

Catalog Number: ATA-HPA066898
Article Name: Anti-JUN
Biozol Catalog Number: ATA-HPA066898
Supplier Catalog Number: HPA066898
Alternative Catalog Number: ATA-HPA066898-100,ATA-HPA066898-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: AP-1, c-Jun
Clonality: Polyclonal
Concentration: 0,2
NCBI: 3725
UniProt: P05412
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSE
Target: JUN
HPA066898-100ul