Anti-PIDD1

Catalog Number: ATA-HPA066948
Article Name: Anti-PIDD1
Biozol Catalog Number: ATA-HPA066948
Supplier Catalog Number: HPA066948
Alternative Catalog Number: ATA-HPA066948-100,ATA-HPA066948-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DKFZp434D229, LRDD, MGC16925, PIDD
Clonality: Polyclonal
Isotype: IgG
NCBI: 55367
UniProt: Q9HB75
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GVSYREVQRIRHEFRDDLDEQIRHMLFSWAERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLELGRRKYQDSIRRMGLA
Target: PIDD1
Antibody Type: Monoclonal Antibody
HPA066948-100ul