Anti-SNTA1

Catalog Number: ATA-HPA067154
Article Name: Anti-SNTA1
Biozol Catalog Number: ATA-HPA067154
Supplier Catalog Number: HPA067154
Alternative Catalog Number: ATA-HPA067154-100,ATA-HPA067154-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: LQT12, SNT1, TACIP1
Clonality: Polyclonal
Isotype: IgG
NCBI: 6640
UniProt: Q13424
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GTRHGVDTHLFSVESPQELAAWTRQLVDGCHRAAEGVQEVSTACTWNGRPCSLSVHIDKGFTLWAAEPGAARAVLLRQPFEKLQMS
Target: SNTA1
Antibody Type: Monoclonal Antibody
HPA067154-100ul