Anti-TSPY1

Catalog Number: ATA-HPA067289
Article Name: Anti-TSPY1
Biozol Catalog Number: ATA-HPA067289
Supplier Catalog Number: HPA067289
Alternative Catalog Number: ATA-HPA067289-100,ATA-HPA067289-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CT78, TSPY
Clonality: Polyclonal
Isotype: IgG
NCBI: 7258
UniProt: Q01534
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: CGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGE
Target: TSPY1
Antibody Type: Monoclonal Antibody
HPA067289-100ul