Anti-HIVEP1

Catalog Number: ATA-HPA067457
Article Name: Anti-HIVEP1
Biozol Catalog Number: ATA-HPA067457
Supplier Catalog Number: HPA067457
Alternative Catalog Number: ATA-HPA067457-100,ATA-HPA067457-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CIRIP, CRYBP1, MBP-1, PRDII-BF1, Schnurri-1, ZAS1, ZNF40, ZNF40A
Clonality: Polyclonal
Isotype: IgG
NCBI: 3096
UniProt: P15822
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: CFSGVHTDPMDVLPRALLTRMTVLSTAQSDYNRKTLSPGKARQRAARDENDTIPSVDTSRSPCHQMSVDYPESEEILRSSMAGKAV
Target: HIVEP1
Antibody Type: Monoclonal Antibody
HPA067457-100ul