Anti-CFAP52, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-CFAP52, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA067544
• Supplier Catalog Number: HPA067544
• Alternative Catalog Number: ATA-HPA067544-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Alternative Names: FLJ37528, WDRPUH

Product Description

Rabbit Polyclonal CFAP52 Antibody against Human cilia and flagella associated protein 52. Validated for Western Blot

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05
• NCBI: 146845
• UniProt: Q8N1V2
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Sequence: VVVWSIAKRDAICGSPAAGLNVGNATNVIFSRCRDEMFMTAGNGTIRVWELDLPNRKIWPTECQTGQLKRIVMSIGVDDD