Anti-CFAP52
Catalog Number:
ATA-HPA067544
| Article Name: |
Anti-CFAP52 |
| Biozol Catalog Number: |
ATA-HPA067544 |
| Supplier Catalog Number: |
HPA067544 |
| Alternative Catalog Number: |
ATA-HPA067544-100 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
WB |
| Species Reactivity: |
Human |
| Alternative Names: |
FLJ37528, WDRPUH |
| Rabbit Polyclonal CFAP52 Antibody against Human cilia and flagella associated protein 52. Validated for Western Blot |
| Clonality: |
Polyclonal |
| Concentration: |
0.05 |
| NCBI: |
146845 |
| UniProt: |
Q8N1V2 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Sequence: |
VVVWSIAKRDAICGSPAAGLNVGNATNVIFSRCRDEMFMTAGNGTIRVWELDLPNRKIWPTECQTGQLKRIVMSIGVDDD |
|
WB Image Caption 1 |