Anti-FURIN

Catalog Number: ATA-HPA067869
Article Name: Anti-FURIN
Biozol Catalog Number: ATA-HPA067869
Supplier Catalog Number: HPA067869
Alternative Catalog Number: ATA-HPA067869-100,ATA-HPA067869-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FUR, PACE, PCSK3, SPC1
Clonality: Polyclonal
Isotype: IgG
NCBI: 5045
UniProt: P09958
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SEANNYGTLTKFTLVLYGTAPEGLPVPPESSGCKTLTSSQACVVCEEGFSLHQKSCVQHCPPGFAPQVLDTHYSTENDVETI
Target: FURIN
Antibody Type: Monoclonal Antibody
HPA067869-100ul