Anti-BCAS2
Catalog Number:
ATA-HPA067881
- Images (10)
| Article Name: | Anti-BCAS2 |
| Biozol Catalog Number: | ATA-HPA067881 |
| Supplier Catalog Number: | HPA067881 |
| Alternative Catalog Number: | ATA-HPA067881-100,ATA-HPA067881-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DAM1, Snt309, SPF27 |
| breast carcinoma amplified sequence 2 |
| Anti-BCAS2 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 10286 |
| UniProt: | O75934 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | BCAS2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles & centrosome. |
|
|
Immunohistochemistry analysis in human thyroid gland and pancreas tissues using Anti-BCAS2 antibody. Corresponding BCAS2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human thyroid gland shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG |
|
|
HPA067881-100ul |
|
|
|
|
|
|
|
|
HPA067881-100ul |
|
|
HPA067881-100ul |
Product Guarantee and Expert Support
