Anti-CHST13

Catalog Number: ATA-HPA067960
Article Name: Anti-CHST13
Biozol Catalog Number: ATA-HPA067960
Supplier Catalog Number: HPA067960
Alternative Catalog Number: ATA-HPA067960-100,ATA-HPA067960-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C4ST3
Clonality: Polyclonal
Isotype: IgG
NCBI: 166012
UniProt: Q8NET6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GNRALGSSWLGGEKRSPLQKLYDLDQDPRSTLAKVHRQRRDLLNSACSRHSRRQRLLQPEDLRHVLVDDAHGLLYCY
Target: CHST13
Antibody Type: Monoclonal Antibody
HPA067960-100ul