Anti-VTN

Catalog Number: ATA-HPA068011
Article Name: Anti-VTN
Biozol Catalog Number: ATA-HPA068011
Supplier Catalog Number: HPA068011
Alternative Catalog Number: ATA-HPA068011-100,ATA-HPA068011-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: VN
Clonality: Polyclonal
Isotype: IgG
NCBI: 7448
UniProt: P04004
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGR
Target: VTN
Antibody Type: Monoclonal Antibody
HPA068011-100ul