Anti-CHST5

Catalog Number: ATA-HPA068029
Article Name: Anti-CHST5
Biozol Catalog Number: ATA-HPA068029
Supplier Catalog Number: HPA068029
Alternative Catalog Number: ATA-HPA068029-100,ATA-HPA068029-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ22167, I-GLCNAC-6-ST
Clonality: Polyclonal
Isotype: IgG
NCBI: 23563
UniProt: Q9GZS9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YRLVRFEDLAREPLAEIRALYAFTGLTLTPQLEAWIHNITHGS
Target: CHST5
Antibody Type: Monoclonal Antibody
HPA068029-100ul